PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100163460051
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 459aa    MW: 50957.1 Da    PI: 8.64
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100163460051genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.62.5e-32320375156
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                   k+r++W+peLH+rFv+a++qLGG++ AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Ote100163460051|100163460051 320 KQRRCWSPELHRRFVSALQQLGGAQAATPKQIRELMQVDGLTNDEVKSHLQKYRLH 375
                                   79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.359317377IPR017930Myb domain
SuperFamilySSF466896.09E-18317378IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-29319378IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-26320375IPR006447Myb domain, plants
PfamPF002491.7E-7322373IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
LFPISDIIIH TQHKHISLTP VKTRPCSTGS SASSIHLPLL SLSKLSGLHI CSQTSRSGNQ  60
MGSLIPPELT LDCSISSNKR WIPKSTGDFL AEVSRMDSVS EKVSKLDDYV NRLQEEMKKI  120
DAFKRELPLC MLLLNDAIAT IRNEIMRCKN SNPGPILEEF IPLKKSSIDE KDERTDDDKE  180
TDIVNRREKM NWMSSVQLWN SDSNSKKIPG FLDKQRKEEA VDRSAIDELF RSGKNRALAK  240
PFSSFKGCSD FPAMAIGKEG RDEFPGAPSL SLRIPEIKNS TEEVFRSGFS SKSSSSRSGS  300
SCGTYSQSSF KAESQQTGRK QRRCWSPELH RRFVSALQQL GGAQAATPKQ IRELMQVDGL  360
TNDEVKSHLQ KYRLHTRRVP PTANASTDIS LWASQEQCGE SSKPTTSNSS SPQGPLHLTG  420
SSRGTSVTAG DSVEEEDDDK SESHSWKSHK QSSERPHGV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011092742.10.0PREDICTED: uncharacterized protein LOC105172852
TrEMBLA0A068TME11e-130A0A068TME1_COFCA; Uncharacterized protein
STRINGSolyc01g108300.2.11e-123(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43612443